PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10021538m
Common NameEUTSA_v10021538mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family Dof
Protein Properties Length: 206aa    MW: 22503 Da    PI: 9.5988
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10021538mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1275.6e-403090262
           zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                     ++++lkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGGalrnvPvGgg+rkn k+s
  Thhalv10021538m 30 EQEQLKCPRCDSPNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGALRNVPVGGGSRKNAKRS 90
                     57899****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-272882IPR003851Zinc finger, Dof-type
PfamPF027012.3E-333288IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3943488IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103672IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MQDPAAYYQT MMAKQQQQTQ TQQQQTQFPE QEQLKCPRCD SPNTKFCYYN NYNLSQPRHF  60
CKSCRRYWTK GGALRNVPVG GGSRKNAKRS TSSSSPPSNS HSKKTKNPDP DPNSQNGTKP  120
DTDPTRMLYG FPIGDQDVKG MEIGGGSSFS SLLASNMQLG LGGIILDGSG WDPGMGLGIG  180
LRRNEAASNG GNPWTDLAMN RVEKN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006406292.11e-153hypothetical protein EUTSA_v10021538mg
SwissprotQ94AR69e-95DOF31_ARATH; Dof zinc finger protein DOF3.1
TrEMBLV4LBD41e-152V4LBD4_EUTSA; Uncharacterized protein
STRINGscaffold_302540.11e-104(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12692896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21270.13e-77DOF zinc finger protein 2